PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009620712.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 275aa    MW: 31806 Da    PI: 6.1617
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009620712.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd  l++ ++++G g+W++ ar+ g++Rt+k+c++rw++yl
   XP_009620712.1 14 RGSWTVEEDFTLINHIALHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding51.62.2e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   XP_009620712.1  67 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 110
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.712961IPR017930Myb domain
SuperFamilySSF466894.87E-3011108IPR009057Homeodomain-like
SMARTSM007173.4E-151363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-211568IPR009057Homeodomain-like
CDDcd001674.51E-111661No hitNo description
PROSITE profilePS5129423.24662116IPR017930Myb domain
SMARTSM007171.3E-1466114IPR001005SANT/Myb domain
PfamPF002494.3E-1567110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2369115IPR009057Homeodomain-like
CDDcd001676.70E-787110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MDHHVNEDNM DFKRGSWTVE EDFTLINHIA LHGEGRWNSL ARCAGLKRTG KSCRLRWLNY  60
LRPDVRRGNI TLEEQLLILE LHSRWGNRWS KIAQHLPGRT DNEIKNYWRT RVQKHAKQLK  120
CDVNSKQFKD TLRYLWMPRL VERIQASSNS AAATNNNNNN NDSNNNNNNS STSVTQENSN  180
VTASSENSMG TQVSPVSDIS DCCYNNYPIN QSDYGEFLIS PTGYFQNGAL DFRTVNDNNQ  240
QNIISQWMEG TEDVSDNLWN IEDMLFLQQQ LNNDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-25910822120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2465821e-51AC246582.4 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-26i13 map 1, complete sequence.
GenBankAC2466421e-51AC246642.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-41f18 map 1, complete sequence.
GenBankHG9754401e-51HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755131e-51HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
GenBankHG9755241e-51HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009620712.10.0PREDICTED: transcription factor MYB108-like
RefseqXP_016489866.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE11e-84MY108_ARATH; Transcription factor MYB108
TrEMBLK4AW021e-120K4AW02_SOLLC; Uncharacterized protein
STRINGSolyc01g057910.2.11e-119(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13972375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.16e-84myb domain protein 78